PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK18183.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family CO-like
Protein Properties Length: 469aa    MW: 54049.6 Da    PI: 6.1385
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK18183.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.43.4e-091659340
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               +r C+ + +k++++fC  ++ +lC++C  + H+       H++v
  PK18183.2 16 ARACDSCLRKRARWFCAADDAFLCQSCDASVHSAnqlasrHERV 59
               578*****************************667888888876 PP

2CCT66.95.4e-23401444144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  PK18183.2 401 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRS 444
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.4E-111461IPR000315B-box-type zinc finger
PROSITE profilePS5011911.1061461IPR000315B-box-type zinc finger
PfamPF006431.0E-71659IPR000315B-box-type zinc finger
CDDcd000215.22E-111761No hitNo description
PROSITE profilePS5101715.993401443IPR010402CCT domain
PfamPF062031.1E-17401443IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MISEKKTANA MAGKTARACD SCLRKRARWF CAADDAFLCQ SCDASVHSAN QLASRHERVR  60
LQTSSFKGIS KISGEVNDSS SPAWLRGFTR KARTPRSNNK GKKKDEEVLP FVPEMSGNEG  120
EDHYDDDDIP LLNYYDHQDD QQLLYQVPIF DPFAVELCNP MSTIDDQDND DDDENDHNRQ  180
NHHHHHHHLI ESTVTHHVDD HHQHDEHEVL GFLPSELELA EFAADVENLL GGGGGVEEEY  240
CCEHEINGFG VIKLLDNCKE EEEEEEEEKL NIKEENEDFF NNIKENNYNY KLDYDHNYNE  300
MEEEGKIVNY NEKKKRKREM TSDVSLSLNL NYEGVIAAWA TQGSPWTTGI RPQLNPAHGW  360
PDHHHLNYMD MWRANTGHNN SGNLMIRGGG RRSNNEVGGG REARVSRYRE KRRTRLFAKK  420
IRYEVRKLNA EKRPRMKGRF VKRSSLTFVN NPPLPITTTT TTSFPNKLK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1411427RRTRLFAKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094760.11e-124Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A023JE591e-130A0A023JE59_BOENI; COL domain class transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.13e-69B-box type zinc finger protein with CCT domain